PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma29g00330.1
Common NameZOSMA_29G00330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family HB-other
Protein Properties Length: 193aa    MW: 22826.9 Da    PI: 8.5857
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma29g00330.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2052107156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      r+k+ ++t++q+ eLe++F++++ p+ +++  L+kklgL+ +qV +WFqNrR k+k
  Zosma29g00330.1  52 RKKKPRHTHQQVGELEAFFKECPSPDFNQIISLSKKLGLKMKQVIYWFQNRRSKMK 107
                      788999************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-1737107IPR009057Homeodomain-like
SuperFamilySSF466891.8E-1838107IPR009057Homeodomain-like
PROSITE profilePS5007115.45149109IPR001356Homeobox domain
SMARTSM003898.1E-1751113IPR001356Homeobox domain
PfamPF000465.3E-1852107IPR001356Homeobox domain
CDDcd000861.73E-1452107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MSMKNEAADG DFEGDFFDKE GEYEYDEHEY DEYEYESDSN KRHKVDELST RRKKKPRHTH  60
QQVGELEAFF KECPSPDFNQ IISLSKKLGL KMKQVIYWFQ NRRSKMKVIL GHQENVFLRE  120
KNDRLRYENM LLIEAPKTPM CKNCKKKSID DLRIKNAHLK EQLERVRSLI KKSIDVSSSS  180
FNNFPCDGGF KN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15055RRKKKP
25056RRKKKPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9PBM81e-142A0A0K9PBM8_Z
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-35HD-ZIP family protein